PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05177g03023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 318aa    MW: 33753.8 Da    PI: 10.9997
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05177g03023.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP32.14e-103563331
                       TCP  3 gkkdrhskihTkvggRdRRvRlsaecaar 31
                              +kk + +++h+kv+gR+RR+R+++ caar
  Niben101Scf05177g03023.1 35 VKKPPVKDRHSKVDGRGRRIRMPIVCAAR 63
                              69999**********************98 PP

2TCP121.97.5e-3891188299
                       TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                               ++kk + +++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as++ ++s s+ +s+ss
  Niben101Scf05177g03023.1  91 TVKKPPVKDRHSKVDGRGRRIRMPIVCAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTIPASFS-TVSVSVRSSSSS 174
                               689******************************************************************888.222222222233 PP

                       TCP  87 sgkaaksaa.kskk 99 
                               +  ++ sa+  +k+
  Niben101Scf05177g03023.1 175 ILTSSISAPlDHKQ 188
                               33222222212222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.3E-74163IPR005333Transcription factor, TCP
PROSITE profilePS5136927.61397151IPR017887Transcription factor TCP subgroup
PfamPF036343.1E-3498186IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MSTSAEGNGA IIDPHQRQQQ QNPSGGGGTN GALIVKKPPV KDRHSKVDGR GRRIRMPIVC  60
AARXEGNGAI IDPHQRQQQQ NPSGGTNGAL TVKKPPVKDR HSKVDGRGRR IRMPIVCAAR  120
VFQLTRELGH KSDGQTIEWL LRQAEPSIIA ATGTGTIPAS FSTVSVSVRS SSSSILTSSI  180
SAPLDHKQPP SSQPLISSAP FILGKRLRTD DESIENGNKE DVGPAATVVG PTPGFWAVPA  240
RPDFGQVWSF AAAPPEMMAP SSAALSLQSS RFFQQQMGEA SAARVGNYLP MTQGHLNLLA  300
SLSGPPQPSS GRRDDDGR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016444705.11e-160PREDICTED: transcription factor TCP7-like
SwissprotQ9FMX22e-90TCP7_ARATH; Transcription factor TCP7
TrEMBLG3BGV41e-142G3BGV4_SOLLC; TCP transcription factor 14
TrEMBLK4BP741e-142K4BP74_SOLLC; Uncharacterized protein
STRINGSolyc04g009180.1.11e-141(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39512242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.12e-74TCP family protein